PDB entry 1e92

View 1e92 on RCSB PDB site
Description: pteridine reductase 1 from leishmania major complexed with nadp+ and dihydrobiopterin
Class: pteridine reductase
Keywords: pteridine reductase, trypanosomatids, drug resistance, pterin salvage, short-chain dehydrogenase/reductase
Deposited on 2000-10-04, released 2001-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e92a_
  • Chain 'B':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e92b_
  • Chain 'C':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e92c_
  • Chain 'D':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e92d_
  • Heterogens: NAP, HBI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e92A (A:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e92A (A:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndgdreametat
    adlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakga
    legltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdv
    viflcsskakyitgtcvkvdggysltra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e92B (B:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e92B (B:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatad
    lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
    gltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvi
    flcsskakyitgtcvkvdggysltra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e92C (C:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e92C (C:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndreametatad
    lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
    gltrsaalelaplqirvngvgpglsvlvghrskvplyqrdssaaevsdvviflcsskaky
    itgtcvkvdggysltra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e92D (D:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e92D (D:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatadl
    fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
    ltrsaalelaplqirvngvgpglsvlvghrskvplyqrdssaaevsdvviflcsskakyi
    tgtcvkvdggysltra