PDB entry 1e91

View 1e91 on RCSB PDB site
Description: structure of the complex of the mad1-sin3b interaction domains
Deposited on 2000-10-04, released 2000-11-20
The last revision prior to the SCOP 1.67 freeze date was dated 2000-12-07, with a file datestamp of 2000-12-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1e91a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e91A (A:)
  esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
  evanlfrgqedllsefgqflpeakr