PDB entry 1e91

View 1e91 on RCSB PDB site
Description: Structure of the complex of the Mad1-Sin3B interaction domains
Class: eukaryotic transcriptional regulation
Keywords: eukaryotic transcriptional regulation, sin3, pah domains, mad1, protein-protein interactions
Deposited on 2000-10-04, released 2000-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: paired amphipathic helix protein sin3b
    Species: Mus musculus [TaxId:10090]
    Gene: SIN3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62141 (0-84)
      • conflict (82)
    Domains in SCOPe 2.08: d1e91a_
  • Chain 'B':
    Compound: mad protein (max dimerizer)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e91A (A:)
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

  • Chain 'B':
    No sequence available.