PDB entry 1e8z

View 1e8z on RCSB PDB site
Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
Class: phosphoinositide 3-kinase gamma
Keywords: phosphoinositide 3-kinase gamma, secondary messenger generation, pi3k, pi 3k, staurosporine
Deposited on 2000-10-03, released 2000-11-17
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase catalytic subunit
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1e8za1, d1e8za2, d1e8za3, d1e8za4
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8zA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8zA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
    deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgidip
    vlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnl
    qiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldn
    hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
    qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
    llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
    ylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsql
    pesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlr
    qdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgnt
    gfkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnl
    fhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsm
    mlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl