PDB entry 1e8z

View 1e8z on RCSB PDB site
Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
Class: transferase
Keywords: transferase, phosphoinositide 3-kinase gamma, secondary messenger generation, pi3k, pi 3k, staurosporine
Deposited on 2000-10-03, released 2000-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736
      • conflict (362)
    • PDB 1E8Z
    Domains in SCOPe 2.07: d1e8za1, d1e8za2, d1e8za3, d1e8za4
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8zA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8zA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
    deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgidip
    vlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnl
    qiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldn
    hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
    qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
    llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
    ylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsql
    pesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlr
    qdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgnt
    gfkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnl
    fhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsm
    mlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl