PDB entry 1e8y

View 1e8y on RCSB PDB site
Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
Class: phosphoinositide 3-kinase gamma
Keywords: phosphoinositide 3-kinase gamma, secondary messenger generation, pi3k, pi 3k
Deposited on 2000-10-03, released 2000-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.245
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (0-End)
      • cloning artefact (0)
      • conflict (362)
    • PDB 1E8Y
    Domains in SCOPe 2.06: d1e8ya1, d1e8ya2, d1e8ya3, d1e8ya4, d1e8ya5
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8yA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8yA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvc
    grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgid
    ipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisill
    dnhpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvk
    wgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvl
    hyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavil
    eaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqns
    qlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgdd
    lrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvg
    ntgfkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetg
    nlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilf
    smmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv
    l