PDB entry 1e8x

View 1e8x on RCSB PDB site
Description:
Deposited on 2000-10-03, released 2000-10-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.255
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8xA (A:)
    aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
    vtskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmakkkslmdi
    pesqnerdfvlrvcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrke
    ewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprtadltv
    fveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapal
    sgktsaempspeskgkaqllyyvnlllidhrfllrhgeyvlhmwqlsgkgedqgsfnadk
    ltsatnpdkensmsisilldnychpialpkhrptpdpegdrvraempnqlrkqleaiiat
    dplnpltaedkellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsa
    ldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfl
    lkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidm
    lqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekc
    kvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesld
    lcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekf
    qaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidfghilgnyksflginke
    rvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpq
    ltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8xA (A:)
    aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
    vtskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmanerdfvlr
    vcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrkecdrkfrvkirgi
    dipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgal
    lnlqiycqllyyvnlllidhrfllrhgeyvlhmwqlsgfnadkltsatnpdkensmsisi
    lldnhpialempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssv
    kwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddv
    lhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavi
    leaylrgcgtamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqn
    lnlpqsfrvpydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgd
    dlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstv
    gntgafkdevlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimise
    tgnlfhidfghvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilf
    smmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlv
    l