PDB entry 1e8u

View 1e8u on RCSB PDB site
Description: structure of the multifunctional paramyxovirus hemagglutinin- neuraminidase
Deposited on 2000-10-01, released 2001-04-03
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-18, with a file datestamp of 2003-07-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1e8ua_
  • Chain 'B':
    Domains in SCOP 1.65: d1e8ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8uA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvrearsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8uA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilknd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8uB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvrearsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8uB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvr