PDB entry 1e8t

View 1e8t on RCSB PDB site
Description: structure of the multifunctional paramyxovirus hemagglutinin-neuraminidase
Class: hydrolase
Keywords: sialidase, neuraminidase, hydrolase, hemagglutinin
Deposited on 2000-10-01, released 2001-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: NEWCASTLE DISEASE VIRUS [TaxId:332244]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e8ta_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase
    Species: NEWCASTLE DISEASE VIRUS [TaxId:332244]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e8tb_
  • Heterogens: CA, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8tA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvrearsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8tA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8tB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvrearsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8tB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvre