PDB entry 1e8s

View 1e8s on RCSB PDB site
Description: alu domain of the mammalian srp (potential alu retroposition intermediate)
Deposited on 2000-09-29, released 2000-11-08
The last revision prior to the SCOP 1.67 freeze date was dated 2001-05-25, with a file datestamp of 2001-05-25.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.388
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1e8sa_
  • Chain 'B':
    Domains in SCOP 1.67: d1e8sb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8sA (A:)
    pqyqtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkk
    iekfhsqlmrlmvakearnvtmete
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8sA (A:)
    qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
    fhsqlmrlmva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8sB (B:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
    dgkkkistvvsskevnkfqmaysnllranmdglkkrdkknktkktk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8sB (B:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydgnkcllratdgkkkistvvsskevnkf
    qmaysnllranmdglk