PDB entry 1e8r

View 1e8r on RCSB PDB site
Description: solution structure of type x cbd
Class: hydrolase
Keywords: hydrolase, beta strands, antiparallel sheets
Deposited on 2000-09-28, released 2000-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14768 (0-49)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d1e8ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8rA (A:)
    mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg