PDB entry 1e8r

View 1e8r on RCSB PDB site
Description: solution structure of type x cbd
Deposited on 2000-09-28, released 2000-10-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-23, with a file datestamp of 2000-10-23.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e8ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8rA (A:)
    mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg