PDB entry 1e8r

View 1e8r on RCSB PDB site
Description: solution structure of type x cbd
Class: hydrolase
Keywords: hydrolase, beta strands, antiparallel sheets
Deposited on 2000-09-28, released 2000-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-1,4-beta-xylanase
  Species: Pseudomonas fluorescens [TaxId:294]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14768 (0-49)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1e8ra1, d1e8ra2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e8rA (A:)
  mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg