PDB entry 1e8q

View 1e8q on RCSB PDB site
Description: characterisation of the cellulose docking domain from piromyces equi
Deposited on 2000-09-28, released 2001-09-07
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-07, with a file datestamp of 2001-09-07.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e8qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8qA (A:)
    ascwaqsqgynccnnpsstkveytdasgqwgvqngqwcgidysygq