PDB entry 1e8q

View 1e8q on RCSB PDB site
Description: characterisation of the cellulose docking domain from piromyces equi
Class: cellulose docking domain
Keywords: cellulose docking domain, cellulase
Deposited on 2000-09-28, released 2001-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e8qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8qA (A:)
    ascwaqsqgynccnnpsstkveytdasgqwgvqngqwcgidysygq