PDB entry 1e8q

View 1e8q on RCSB PDB site
Description: Characterisation of the cellulose docking domain from Piromyces equi
Class: cellulose docking domain
Keywords: cellulose docking domain, cellulase
Deposited on 2000-09-28, released 2001-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endoglucanase 45a
  Species: PIROMYCES EQUI [TaxId:99929]
  Gene: cel45A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P868 (0-45)
    • conflict (1)
  Domains in SCOPe 2.08: d1e8qa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e8qA (A:)
  ascwaqsqgynccnnpsstkveytdasgqwgvqngqwcgidysygq