PDB entry 1e8o

View 1e8o on RCSB PDB site
Description:
Deposited on 2000-09-28, released 2000-11-08
The last revision prior to the SCOP 1.63 freeze date was dated 2000-11-08, with a file datestamp of 2000-11-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.245
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1e8oa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1e8ob_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1e8oc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1e8od_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8oA (A:)
    pqyqtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkk
    iekfhsqlmrlmva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8oB (B:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
    dgkkkistvvsskevnkfqmaysnllranmdglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8oB (B:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydnkcllratdgkkkistvvsskevnkfq
    maysnllranmdglk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8oC (C:)
    qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
    fhsqlmrlmva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e8oD (D:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
    dgkkkistvvsskevnkfqmaysnllranmdglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8oD (D:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydgnkcllratdgkkkistvvsskevnkf
    qmaysnllranmdglk