PDB entry 1e8n

View 1e8n on RCSB PDB site
Description: prolyl oligopeptidase from porcine brain, mutant, complexed with peptide
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, prolyl oligopeptidase, amnesia, alpha/beta-hydrolase, beta-propeller, hydrolase-hydrolase inhibitor complex
Deposited on 2000-09-27, released 2001-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: SUS SCROFA [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23687 (0-709)
      • engineered mutation (553)
    Domains in SCOPe 2.08: d1e8na1, d1e8na2
  • Chain 'I':
    Compound: peptide inhibitor
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E8N (0-End)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8nA (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltingganggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip
    

  • Chain 'I':
    No sequence available.