PDB entry 1e8m

View 1e8m on RCSB PDB site
Description: prolyl oligopeptidase from porcine brain, mutant, complexed with inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, prolyl oligopeptidase, amnesia, alpha/ beta-hydrolase, beta-propeller, hydrolase-hydrolase inhibitor complex
Deposited on 2000-09-27, released 2001-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.193
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: SUS SCROFA [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23687 (0-709)
      • engineered mutation (553)
    Domains in SCOPe 2.06: d1e8ma1, d1e8ma2
  • Heterogens: GOL, P0H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8mA (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltingganggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip