PDB entry 1e8j

View 1e8j on RCSB PDB site
Description: solution structure of desulfovibrio gigas zinc rubredoxin, nmr, 20 structures
Class: electron transport
Keywords: electron transport, zinc-substitution, thermostability
Deposited on 2000-09-21, released 2001-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Desulfovibrio gigas [TaxId:879]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00270 (0-51)
  Domains in SCOPe 2.08: d1e8ja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e8jA (A:)
  mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq