PDB entry 1e8i

View 1e8i on RCSB PDB site
Description:
Deposited on 2000-09-21, released 2000-09-26
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-18, with a file datestamp of 2003-07-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.248
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1e8ia_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1e8ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8iA (A:)
    vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
    wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8iA (A:)
    sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
    vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8iB (B:)
    vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
    wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8iB (B:)
    sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
    vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk