PDB entry 1e8g

View 1e8g on RCSB PDB site
Description: structure of the h61t double mutant of vanillyl-alcohol oxidase in complex with fluoro-cresol
Deposited on 2000-09-20, released 2000-09-21
The last revision prior to the SCOP 1.57 freeze date was dated 2000-09-21, with a file datestamp of 2000-09-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8gA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdpthvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8gA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdpthvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8gB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdpthvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8gB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdpthvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl