PDB entry 1e8f

View 1e8f on RCSB PDB site
Description: structure of the h61t mutant of the flavoenzyme vanillyl-alcohol oxidase in the apo form
Deposited on 2000-09-20, released 2000-09-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-21, with a file datestamp of 2000-09-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8fA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdpthvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8fA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevismkpththdpthvmdqdyflasaiv
    aprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrvlevnv
    egaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpygdhwm
    mhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyidglfs
    qsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhil
    ldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdaf
    saipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiakvsged
    ammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddc
    aangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwpsqysh
    vtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8fB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdpthvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8fB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevismkpththdpthvmdqdyflasaiv
    aprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrvlevnv
    egaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpygdhwm
    mhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyidglfs
    qsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhil
    ldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdaf
    saipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiakvsged
    ammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddc
    aangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwpsqysh
    vtwkl