PDB entry 1e8f

View 1e8f on RCSB PDB site
Description: structure of the h61t mutant of the flavoenzyme vanillyl-alcohol oxidase in the apo form
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, methanol utilization, peroxisome, flavoenzyme, oxidase, catalysis
Deposited on 2000-09-20, released 2000-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.239
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56216 (Start-559)
      • engineered (60)
    Domains in SCOPe 2.07: d1e8fa1, d1e8fa2
  • Chain 'B':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56216 (Start-559)
      • engineered (60)
    Domains in SCOPe 2.07: d1e8fb1, d1e8fb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8fA (A:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    thvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8fA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevismkpththdpthvmdqdyflasaiv
    aprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrvlevnv
    egaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpygdhwm
    mhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyidglfs
    qsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhil
    ldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdaf
    saipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiakvsged
    ammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddc
    aangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwpsqysh
    vtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8fB (B:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    thvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8fB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevismkpththdpthvmdqdyflasaiv
    aprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrvlevnv
    egaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpygdhwm
    mhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyidglfs
    qsnmgivtkigiwlmpnpggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhil
    ldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdaf
    saipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiakvsged
    ammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddc
    aangwgeyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwpsqysh
    vtwkl