PDB entry 1e8d

View 1e8d on RCSB PDB site
Description: on the mechanism of cyanogenesis catalyzed by hydroxynitrile lyase from manihot esculenta. crystal structure of active site mutant ser80ala in complex with acetone cyanohydrin
Class: lyase
Keywords: lyase, hydroxynitrile lyase, active site mutant, acetone cyanohydrin complex
Deposited on 2000-09-19, released 2001-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxynitrile lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E8D (0-4)
      • cloning artifact (0-4)
      • engineered mutation (83)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1e8da1, d1e8da2
  • Chain 'B':
    Compound: hydroxynitrile lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E8D (Start-4)
      • cloning artifact (4)
      • engineered mutation (83)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1e8db1, d1e8db2
  • Heterogens: CNH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8dA (A:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8dB (B:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8dB (B:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya