PDB entry 1e8c

View 1e8c on RCSB PDB site
Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli
Deposited on 2000-09-19, released 2001-09-13
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-13, with a file datestamp of 2001-09-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8cA (A:)
    rnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaai
    iaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhepsdnlrlvgvtgtngkttt
    tqllaqwsqllgeisavmgtvgngllgkviptenttgsavdvqhelaglvdqgatfcame
    vsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaakwllysehhcgqaiinadd
    evgrrwlaklpdavavsmedhinpnchgrwlkatevnyhdsgatirfssswgdgeieshl
    mgafnvsnlllalatllalgypladllktaarlqpvcgrmevftapgkptvvvdyahtpd
    alekalqaarlhcagklwcvfgcggdrdkgkrplmgaiaeefadvavvtddnprteepra
    iindilagmldaghakvmegraeavtcavmqakendvvlvagkghedyqivgnqrldysd
    rvtvarllgviarsh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8cB (B:)
    drnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaa
    iiaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhepsdnlrlvgvtgtngktt
    ttqllaqwsqllgeisavmgtvgngllgkviptenttgsavdvqhelaglvdqgatfcam
    evsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaakwllysehhcgqaiinad
    devgrrwlaklpdavavsmedhinpnchgrwlkatevnyhdsgatirfssswgdgeiesh
    lmgafnvsnlllalatllalgypladllktaarlqpvcgrmevftapgkptvvvdyahtp
    dalekalqaarlhcagklwcvfgcggdrdkgkrplmgaiaeefadvavvtddnprteepr
    aiindilagmldaghakvmegraeavtcavmqakendvvlvagkghedyqivgnqrldys
    drvtvarllgviarshh