PDB entry 1e8b

View 1e8b on RCSB PDB site
Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
Deposited on 2000-09-18, released 2000-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 2001-05-25, with a file datestamp of 2001-05-25.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8bA (A:)
    yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqetavtqtyggnsngepcvlpf
    tyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdhtvlvqtrggnsngalchfpf
    lynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma