PDB entry 1e8a

View 1e8a on RCSB PDB site
Description: the three-dimensional structure of human s100a12
Class: antifungal protein
Keywords: antifungal protein, s100 protein, x-ray structure, ef-hand, calcium binding
Deposited on 2000-09-18, released 2001-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.18
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e8aa_
  • Chain 'B':
    Compound: s100a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e8ab_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8aA (A:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8aA (A:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8aB (B:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8aB (B:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyht