PDB entry 1e89

View 1e89 on RCSB PDB site
Description: on the mechanism of cyanogenesis catalyzed by hydroxynitrile lyase from manihot esculenta. crystal structure of active site mutant ser80ala in complex with acetone cyanohydrin
Class: lyase
Keywords: lyase, hydroxynitrile lyase, active site mutant, acetone cyanohydrin complex
Deposited on 2000-09-18, released 2001-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxynitrile lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E89 (0-4)
      • engineered mutation (83)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1e89a1, d1e89a2
  • Chain 'B':
    Compound: hydroxynitrile lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E89 (Start-4)
      • engineered mutation (83)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1e89b1, d1e89b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e89A (A:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e89B (B:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e89B (B:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya