PDB entry 1e88

View 1e88 on RCSB PDB site
Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
Deposited on 2000-09-18, released 2000-10-09
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-25, with a file datestamp of 2001-05-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1e88a1, d1e88a2, d1e88a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e88A (A:)
  yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqetavtqtyggnsngepcvlpf
  tyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdhtvlvqtrggnsngalchfpf
  lynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma