PDB entry 1e88

View 1e88 on RCSB PDB site
Description: Solution structure of 6F11F22F2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
Class: cell adhesion
Keywords: extracellular matrix glycoprotein, cell adhesion
Deposited on 2000-09-18, released 2000-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-159)
  Domains in SCOPe 2.08: d1e88a1, d1e88a2, d1e88a3
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e88A (A:)
  yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqetavtqtyggnsngepcvlpf
  tyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdhtvlvqtrggnsngalchfpf
  lynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma