PDB entry 1e87

View 1e87 on RCSB PDB site
Description:
Deposited on 2000-09-18, released 2000-09-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-18, with a file datestamp of 2003-07-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.229
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1e87a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e87A (A:)
    vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
    wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e87A (A:)
    sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
    vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk