PDB entry 1e85

View 1e85 on RCSB PDB site
Description: cytochrome c' from alcaligenes xylosoxidans-reduced structure with no bound to proximal side of heme
Class: electron transport
Keywords: electron transport, cytochrome, heme, 4-helix bundle, nitric oxide
Deposited on 2000-09-15, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.194
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e85a_
  • Heterogens: HEC, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e85A (A:)
    efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e85A (A:)
    efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrk