PDB entry 1e84

View 1e84 on RCSB PDB site
Description: Cytochrome c' from Alcaligenes xylosoxidans - reduced structure
Class: electron transport
Keywords: cytochrome, heme, 4-helix bundle, electron transport
Deposited on 2000-09-15, released 2000-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: ALCALIGENES XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00138 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.08: d1e84a_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e84A (A:)
    efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e84A (A:)
    efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrkk