PDB entry 1e7y

View 1e7y on RCSB PDB site
Description: active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides complexed with substrate and nadph
Class: oxidoreductase
Keywords: oxidoreductase (choh(d) - nad(p)), glucose metabolism
Deposited on 2000-09-12, released 2000-12-11
The last revision prior to the SCOP 1.75 freeze date was dated 2000-12-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.205
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose 6-phosphate 1-dehydrogenase
    Species: Leuconostoc mesenteroides
    Gene: PLMZ/D177NURCE 9 OTHER_DETAILS: SITE DIRECTED MUTAGENESIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11411 (0-484)
      • engineered mutation (176)
    Domains in SCOP 1.75: d1e7ya1, d1e7ya2
  • Heterogens: BG6, CA, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7yA (A:)
    vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
    sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
    rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfrinhyl
    gkemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnh
    tmqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpy
    leeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgs
    eqeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpepyermih
    dtmngdgsnfadwngvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangda
    wvfkg