PDB entry 1e7x

View 1e7x on RCSB PDB site
Description: ms2-RNA hairpin (2one-5) complex
Class: complex (capsid protein/RNA hairpin)
Keywords: complex (capsid protein/RNA hairpin), hairpin, capsid, levivirus
Deposited on 2000-09-12, released 2000-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-11-07, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ms2
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7xa_
  • Chain 'B':
    Compound: ms2
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7xb_
  • Chain 'C':
    Compound: ms2
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7xc_
  • Chain 'R':
    Compound: RNA
  • Chain 'S':
    Compound: RNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7xA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7xB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7xC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.