PDB entry 1e7w

View 1e7w on RCSB PDB site
Description: one active site, two modes of reduction correlate the mechanism of leishmania pteridine reductase with pterin metabolism and antifolate drug resistance in trpanosomes
Class: dihydrofolate reductase
Keywords: dihydrofolate reductase, pteridine reductase, shortchain dehydrogenase, methotrexate resistance
Deposited on 2000-09-11, released 2001-09-06
The last revision prior to the SCOP 1.75 freeze date was dated 2002-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.196
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e7wa_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e7wb_
  • Heterogens: NDP, MTX, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7wA (A:)
    gshmtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpn
    saitvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptp
    llrndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysii
    nmvdamtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppav
    weghrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7wA (A:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapvssapvtlftrcaelvaacythwgrcdvlvnnassfyptpllreametata
    dlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgal
    egltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvv
    iflcsskakyitgtcvkvdggysltra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e7wB (B:)
    gshmtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpn
    saitvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptp
    llrndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysii
    nmvdamtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppav
    weghrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7wB (B:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrgdreametatadlf
    gsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegl
    trsaalelaplqirvngvgpglsvlvdweghrskvplyqrdssaaevsdvviflcsskak
    yitgtcvkvdggysltra