PDB entry 1e7v

View 1e7v on RCSB PDB site
Description:
Deposited on 2000-09-08, released 2000-11-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.273
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7vA (A:)
    aseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpwv
    tskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmakkkslmdip
    esqnerdfvlrvcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprtadltvf
    veaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    gktsaempspeskgkaqllyyvnlllidhrfllrhgeyvlhmwqlsgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhrptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidml
    qkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekfq
    aaverfvyscagycvatfvlgigdrhndnimisetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7vA (A:)
    aseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpwv
    tskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmadfvlrvcgr
    deylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrkelwdcdrkfrvkirgid
    ipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycqllyyvnlllidhrfllrhgeyvlhmwqlsfnadkltsatnpdkensmsisill
    dnychpialpkempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfs
    svkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledd
    dvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfa
    vileaylrgcgtamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenl
    qnlnlpqsfrvpydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkh
    gddlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqs
    tvgntgafkdevlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimi
    setgnlfhidfghinkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhht
    nlliilfsmmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqf
    nwflhlvlgi