PDB entry 1e7u

View 1e7u on RCSB PDB site
Description:
Deposited on 2000-09-08, released 2000-11-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-01, with a file datestamp of 2000-12-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.254
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7uA (A:)
    aseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpwv
    tskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmakkkslmdip
    esqnerdfvlrvcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprtadltvf
    veaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgakpals
    gktsaempspeskgakqllyyvnlllidhrfllrhgeyvlhmwqlsgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhrptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidml
    qkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekfq
    aaverfvyscagycvatfvlgigdrhndnimisetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7uA (A:)
    aseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpwv
    tskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmaknerdfvlr
    vcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrketvslwdcdrkfr
    vkirgidipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikd
    lpkgallnlqiycgakqllyyvnlllidhrfllrhgeyvlhmwqlsgkgfnadkltsatn
    pdkensmsisilldnychpialpkhrptdrvraempnqlrkqleaiiatdplnpltaedk
    ellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlld
    cnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrig
    hflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidmlqkvtidiksl
    saekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekckvmaskkkplw
    lefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlcllpygcist
    gdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekfqaaverfvysc
    agycvatfvlgigdrhndnimisetgnlfhidfghinkervpfvltpdflfvmgtsgkkt
    slhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpqltskedieyirdaltvgksee
    dakkyfldqievcrdkgwtvqfnwflhlvlgi