PDB entry 1e7t

View 1e7t on RCSB PDB site
Description: human vimentin coil 2b fragment linked to gcn4 leucine zipper
Deposited on 2000-09-07, released 2001-09-06
Made obsolete by 1gk6 on 2003-03-27

The last revision was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: general control protein gcn4, vimentin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: general control protein gcn4, vimentin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1e7tA (A:)
    rmkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrkllegeesris
    

    Sequence, based on observed residues (ATOM records):
    >1e7tA (A:)
    mkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrkllegees
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1e7tB (B:)
    rmkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrkllegeesris
    

    Sequence, based on observed residues (ATOM records):
    >1e7tB (B:)
    mkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrklleg