PDB entry 1e7s

View 1e7s on RCSB PDB site
Description: GDP 4-keto-6-deoxy-d-mannose epimerase reductase k140r
Class: epimerase/reductase
Keywords: epimerase/reductase, sdr, red
Deposited on 2000-09-07, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.126
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32055
      • engineered mutation (139)
      • conflict (194)
    Domains in SCOPe 2.07: d1e7sa_
  • Heterogens: NAP, UVW, SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7sA (A:)
    mskqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvy
    laaakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpma
    esellqgtleptnepyaiariagiklcesynrqygrdyrsvmptnlygphdnfhpsnshv
    ipallrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpml
    shinvgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheis
    leaglastyqwflenqdrfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7sA (A:)
    kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
    aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
    ellqgtleptnepyaiariagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
    allrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
    invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
    aglastyqwflenq