PDB entry 1e7s

View 1e7s on RCSB PDB site
Description: GDP 4-keto-6-deoxy-D-mannose epimerase reductase K140R
Class: epimerase/reductase
Keywords: EPIMERASE/REDUCTASE, SDR, RED, EPIMERASE-REDUCTASE complex
Deposited on 2000-09-07, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32055
      • engineered mutation (139)
      • conflict (194)
    Domains in SCOPe 2.08: d1e7sa_
  • Heterogens: NAP, UVW, SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7sA (A:)
    mskqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvy
    laaakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpma
    esellqgtleptnepyaiariagiklcesynrqygrdyrsvmptnlygphdnfhpsnshv
    ipallrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpml
    shinvgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheis
    leaglastyqwflenqdrfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7sA (A:)
    kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
    aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
    ellqgtleptnepyaiariagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
    allrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
    invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
    aglastyqwflenq