PDB entry 1e7r

View 1e7r on RCSB PDB site
Description: GDP 4-keto-6-deoxy-d-mannose epimerase reductase y136e
Class: epimerase/reductase
Keywords: epimerase/reductase, sdr, red
Deposited on 2000-09-07, released 2000-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2000-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.139
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose synthetase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32055
      • engineered mutation (135)
      • conflict (194)
    Domains in SCOP 1.73: d1e7ra_
  • Heterogens: SO4, NAP, UVW, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7rA (A:)
    mskqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvy
    laaakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpma
    esellqgtleptnepeaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshv
    ipallrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpml
    shinvgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheis
    leaglastyqwflenqdrfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7rA (A:)
    kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
    aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
    ellqgtleptnepeaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
    allrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
    invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
    aglastyqwflenq