PDB entry 1e7o

View 1e7o on RCSB PDB site
Description: a-spectrin sh3 domain a11v, v23l, m25v, v44i, v58l mutations
Deposited on 2000-08-31, released 2003-05-21
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-21, with a file datestamp of 2003-05-21.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.234
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1e7oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7oA (A:)
    mdetgkelvlvlydyqekspreltvkkgdiltllnstnkdwwkievndrqgfvpaaylkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7oA (A:)
    tgkelvlvlydyqekspreltvkkgdiltllnstnkdwwkievndrqgfvpaaylkkld