PDB entry 1e7o

View 1e7o on RCSB PDB site
Description: a-spectrin sh3 domain a11v, v23l, m25v, v44i, v58l mutations
Class: structural protein
Keywords: sh3-domain, cytoskeleton, calmodulin-binding, actin-binding, structural protein
Deposited on 2000-08-31, released 2003-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.234
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E7O
      • engineered (10)
      • engineered (22)
      • engineered (24)
      • engineered (43)
      • engineered (57)
    • Uniprot P07751 (Start-61)
    Domains in SCOPe 2.07: d1e7oa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7oA (A:)
    mdetgkelvlvlydyqekspreltvkkgdiltllnstnkdwwkievndrqgfvpaaylkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7oA (A:)
    tgkelvlvlydyqekspreltvkkgdiltllnstnkdwwkievndrqgfvpaaylkkld