PDB entry 1e7n

View 1e7n on RCSB PDB site
Description: the n-terminal domain of beta-b2-crystallin resembles the putative ancestral homodimer
Deposited on 2000-08-31, released 2000-10-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-11, with a file datestamp of 2000-12-11.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e7na_
  • Chain 'B':
    Domains in SCOP 1.55: d1e7nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7nA (A:)
    lnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvgyeqanckgeqfvf
    ekgeyprwdswtssrrtdslsslrpikvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7nB (B:)
    lnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvgyeqanckgeqfvf
    ekgeyprwdswtssrrtdslsslrpikvd