PDB entry 1e7m

View 1e7m on RCSB PDB site
Description: active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Class: oxidoreductase
Keywords: oxidoreductase, oxidoreductase (choh(d) - nad(p)), glucose metabolism
Deposited on 2000-08-30, released 2000-12-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose 6-phosphate 1-dehydrogenase
    Species: LEUCONOSTOC MESENTEROIDES [TaxId:1245]
    Gene: PLMZ/D177N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11411 (0-484)
      • engineered mutation (176)
    Domains in SCOPe 2.01: d1e7ma1, d1e7ma2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7mA (A:)
    vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
    sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
    rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfrinhyl
    gkemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnh
    tmqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpy
    leeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgs
    eqeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpepyermih
    dtmngdgsnfadwngvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangda
    wvfkg