PDB entry 1e7l

View 1e7l on RCSB PDB site
Description: endonuclease vii (endovii) n62d mutant from phage t4
Class: endonuclease
Keywords: endonuclease, resolvase, holliday junction, DNAse
Deposited on 2000-08-29, released 2001-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.145
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombination endonuclease vii
    Species: Bacteriophage T4 [TaxId:10665]
    Gene: GP49
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13340 (0-156)
      • engineered mutation (61)
    Domains in SCOPe 2.07: d1e7la1, d1e7la2
  • Chain 'B':
    Compound: recombination endonuclease vii
    Species: Bacteriophage T4 [TaxId:10665]
    Gene: GP49
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13340 (0-156)
      • engineered mutation (61)
    Domains in SCOPe 2.07: d1e7lb1, d1e7lb2
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7lA (A:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cdaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7lB (B:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cdaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk