PDB entry 1e7j

View 1e7j on RCSB PDB site
Description: hmg-d complexed to a bulge DNA
Class: protein/DNA
Keywords: protein/DNA, protein-DNA complex
Deposited on 2000-08-29, released 2001-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: high mobility group protein d
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05783 (0-73)
  Domains in SCOPe 2.08: d1e7ja_
• Chain 'B':
  Compound: DNA (5'-d(*cp*gp*ap*tp*ap*tp*tp*ap*ap*gp*ap*gp*cp*c)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*gp*gp*cp*tp*cp*ap*ap*tp*ap*tp*cp*g)-3')
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e7jA (A:)
  msdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakak
  ddydravkefeang
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.