PDB entry 1e7j

View 1e7j on RCSB PDB site
Description: hmg-d complexed to a bulge DNA
Class: protein/DNA
Keywords: protein/DNA, protein-DNA complex
Deposited on 2000-08-29, released 2001-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7ja_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*ap*tp*ap*tp*tp*ap*ap*gp*ap*gp*cp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*gp*cp*tp*cp*ap*ap*tp*ap*tp*cp*g)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7jA (A:)
    msdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakak
    ddydravkefeang
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.