PDB entry 1e7d

View 1e7d on RCSB PDB site
Description: endonuclease vii (endovii) from phage t4
Class: hydrolase
Keywords: hydrolase, endonuclease, resolvase, holliday junction, DNAse
Deposited on 2000-08-28, released 2001-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.245
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombination endonuclease vii
    Species: Bacteriophage T4 [TaxId:10665]
    Gene: GP49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7da1, d1e7da2
  • Chain 'B':
    Compound: recombination endonuclease vii
    Species: Bacteriophage T4 [TaxId:10665]
    Gene: GP49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7db1, d1e7db2
  • Heterogens: ZN, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7dA (A:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7dB (B:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk