PDB entry 1e77

View 1e77 on RCSB PDB site
Description: complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with substrate
Deposited on 2000-08-24, released 2000-12-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-11, with a file datestamp of 2000-12-11.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.18
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e77A (A:)
    vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
    sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
    rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
    gkemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnh
    tmqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpy
    leeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgs
    eqeaceavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpepyermih
    dtmngdgsnfadwngvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangda
    wvfkg