PDB entry 1e70

View 1e70 on RCSB PDB site
Description: 2-f-glucosylated myrosinase from sinapis alba
Class: hydrolase
Keywords: hydrolase, family 1 glycosyl hydrolase, glucosinolate, myrosinase, tim barrel, glucosyl enzyme
Deposited on 2000-08-23, released 2001-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.169
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: myrosinase ma1
    Species: SINAPIS ALBA [TaxId:3728]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e70m_
  • Heterogens: NAG, G2F, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1e70M (M:)
    deeitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypn
    ksgpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidy
    yhglisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvk
    ywltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdl
    yrknythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimi
    dtvgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyi
    nasghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenr
    nqsmldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidw
    nnvtdrdlkksgqwyqsfisp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e70M (M:)
    eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks
    gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh
    glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw
    ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr
    knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt
    vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina
    sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq
    smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn
    vtdrdlkksgqwyqsfisp